Recombinant Human Kallikrein-2 (KLK2) (Active)

SKU: orb3155660

Active

Description

Images & Validation

−

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	①Measured by its binding ability in a functional ELISA. Immobilized Human KLK2 at 2 μg/mL can bind Anti-KLK2 recombinant antibody (CSB-RA012453MA1HU). The EC50 is 0.6741-0.8245 ng/mL. ②Measured by its ability to cleave a flourogenic peptide substrate Pro-Phe-Arg-7-amido-4-methylcoumarin (PFR-AMC). The specific activity is >350 pmol/min/µg.
Tag	C-terminal 10xHis-tagged
Molecular Weight	29.6 kDa
Expression Region	19-261aa
Protein Length	Full Length
Protein Sequence	PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxins	Less than 1.0 EU/ug as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Liquid
Buffer/Preservatives	0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Kallikrein-2; EC 3.4.21.35; Glandular kallikrein-1; hGK-1; Tissue kallikrein-2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

P20151

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols