Recombinant Human Leukemia inhibitory factor (LIF)

SKU: orb1785348

Featured

Description

This Recombinant Human Leukemia inhibitory factor (LIF) spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

−

Item 1 of 2

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Tag	C-terminal 10xHis-tagged
Molecular Weight	23.1 kDa
Expression Region	23-202aa
Protein Length	Full Length of Mature Protein
Protein Sequence	SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Purity	Greater than 90% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Disclaimer	For research use only

Alternative Names

−

(LIF)(Differentiation-stimulating factor)(D factor)(Melanoma-derived LPL inhibitor)(MLPLI)(Emfilermin)

Human LIF Protein, hFc Tag [orb1290937]

Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 46 kDa after removal of the signal peptide. The apparent molecular mass of LIF-His is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

Item 1 of 1
Recombinant Human Leukemia inhibitory factor receptor (LIFR), partial [orb2658116]
Purity:
Greater than 95% as determined by SDS-PAGE.
MW:
92.6 kDa
Source:
Mammalian cell
Sizes Available: 1 mg, 20 μg, 100 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Recombinant Human Leukemia inhibitory factor (LIF)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human LIF at 2 μg/ml can bind Human LIFR protein. The EC50 is 8.067-9.260 ng/mL.

Quick Database Links

UniProt

P15018

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols