You have no items in your shopping cart.
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial (Active)
SKU: orb2280235
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human FCGR2A at 2 μg/mL can bind Anti-FCGR2A recombinant antibody. The EC50 is 24.44-32.57 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 23.2 kDa |
| Expression Region | 34-217aa |
| Protein Length | Partial |
| Protein Sequence | QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG |
| Purity | Greater than 95% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Low affinity immunoglobulin gamma Fc region receptor II-a; IgG Fc receptor II-a; CDw32; Fc-gamma RII-a (Fc-gamma-RIIa; FcRII-a); CD32; FCGR2A; CD32, FCG2, FCGR2A1, IGFR2

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of FCGR2A was greater than 90% as determined by SEC-HPLC
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial (Active) (orb2280235)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review