Recombinant Human MIP-3 alpha (rHuMIP-3a/CCL20)

SKU: orb1494948

Description

MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.

Images & Validation

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. Read more...

Key Properties

−

Source	Escherichia coli.
Biological Activity	Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 10.0 -50.0 ng/ml, corresponding to a Specific Activity of ＞2 x 104 IU/mg.
Molecular Weight	8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
Protein Sequence	ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Purification	>97% by SDS-PAGE and HPLC analyses.
Purity	>97% by SDS-PAGE and HPLC analyses.
Endotoxins	Less than 1EU/mg of rHuMIP-3a/CCL20 as determined by LAL method.

Storage & Handling

−

Storage	This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Form/Appearance	Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Buffer/Preservatives	Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols