You have no items in your shopping cart.
Recombinant Human NAP-2 (rHuNAP-2/CXCL7)
SKU: orb1495028
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia coli. |
|---|---|
| Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human neutrophils using a concentration range of 1.0-10.0 ng/ml, corresponding to a Specific Activity of >1 x 105 IU/mg |
| Molecular Weight | 7.6 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. |
| Protein Sequence | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
| Purification | >97% by SDS-PAGE and HPLC analyses. |
| Purity | >97% by SDS-PAGE and HPLC analyses. |
| Endotoxins | Less than 1EU/mg of rHuNAP-2/CXCL7 as determined by LAL method. |
Storage & Handling
−| Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl. |
| Buffer/Preservatives | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human NAP-2 (rHuNAP-2/CXCL7) (orb1495028)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review