You have no items in your shopping cart.
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial (Active)
Description
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind human ACE2, the EC50 is 6.597-8.187 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind Biotin-S Antibody, the EC50 is 21.54-26.77 ng/ml. |
| Tag | C-terminal mFc-tagged |
| Molecular Weight | 54.4 kDa |
| Expression Region | 319-541aa(E484K) |
| Protein Length | Partial |
| Protein Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind human ACE2, the EC50 is 6.597-8.187 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind Biotin-S Antibody, the EC50 is 21.54-26.77 ng/ml.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial (Active) (orb1096687)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review