You have no items in your shopping cart.
Recombinant Human Peroxisomal biogenesis factor 19(PEX19) (Active)
SKU: orb1646261
Description
Images & Validation
−
Key Properties
−| Expression System | E.coli |
|---|---|
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 g,ml can bind human PEX19,the EC50 of human PEX19 protein is 22.96-33.00 g,ml. |
| Tag | N-terminal GST-tagged |
| Molecular Weight | 59.3 kDa |
| Protein Sequence | AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Tris-based buffer, 50% glycerol |
| Disclaimer | For research use only |
Alternative Names
−33 kDa housekeeping protein Peroxin-19 Peroxisomal farnesylated protein

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Peroxisomal biogenesis factor 19(PEX19) (Active) (orb1646261)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review