You have no items in your shopping cart.
Recombinant Human Placenta growth factor (PGF) (Active)
SKU: orb1785323
Featured
Description
Research Area
Cardiovascular Research
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human FLT1(CSB-MP008732HU) protein at 2 μg/mL can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL. |
| Tag | C-terminal hFc1-tagged |
| Molecular Weight | 45.1 kDa |
| Expression Region | 19-170aa |
| Protein Length | Full Length of Mature Protein of Isoform PlGF-2 |
| Protein Sequence | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Placenta growth factor; PlGF; PGF; PGFL, PLGF
Similar Products
−Recombinant Human Placenta growth factor protein(PGF) (Active) [orb1650580]
5 μg, 25 μg, 100 μg, 500 μg, 1 mg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Placenta growth factor (PGF) (Active) (orb1785323)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review