Cart summary

You have no items in your shopping cart.

Recombinant Human T-cell surface glycoprotein CD8 alpha&beta Heterodimer Protein (CD8A&CD8B)

SKU: orb2986006

Description

This Recombinant Human T-cell surface glycoprotein CD8 alpha&beta Heterodimer Protein (CD8A&CD8B) spans the amino acid sequence from region 1-182aa&22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceMammalian cell
Biological OriginHomo sapiens (Human)
TagC-terminal 10xHis-tagged&C-terminal Twin-Strep-tagged
Molecular Weight19.8 kDa&19.8 kDa
Expression Region1-182aa&22-170aa
Protein LengthHeterodimer
Protein SequenceMALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD&LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
PurityGreater than 90% as determined by SDS-PAGE.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/AppearanceLiquid or Lyophilized powder
Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Human T-cell surface glycoprotein CD8 alpha&beta Heterodimer Protein (CD8A&CD8B) (orb2986006)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 210.00
100 μg
$ 390.00
1 mg
$ 2,820.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry