Recombinant Human Thymic stromal lymphopoietin (TSLP) (Active)

SKU: orb2986246

Description

This Recombinant Human Thymic stromal lymphopoietin (TSLP) (Active) spans the amino acid sequence from region 29-159aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	①Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 2 μg/mL can bind Anti-TSLP recombinant antibody. The EC50 is 5.487-6.214 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 2 μg/mL can bind Human CRLF2 protein. The EC50 is 41.01-45.10 ng/mL.
Tag	N-terminal 6xHis-Myc-tagged
Molecular Weight	19.1 kDa
Expression Region	29-159aa
Protein Length	Full Length of Mature Protein
Protein Sequence	YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Disclaimer	For research use only

Alternative Names

−

Thymic stromal lymphopoietin; TSLP

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

Q969D9

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols