Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial (Active)

SKU: orb1096333

Featured

Description

This Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial spans the amino acid sequence from region 19-174aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

−

Item 1 of 1

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	①Measured by its binding ability in a functional ELISA.Immobilized Human TREM2 at 2 μg/mL can bind Anti-TREM2 recombinant antibody(CSB-RA024405MA5HU). The EC50 is 1.145-1.358 ng/mL. ②TREM2 Recombinant Monoclonal Antibody (CSB-RA024405MA5HU) captured on Protein A Chip can bind Recombinant Human TREM2 with an affinity constant of 0.146 nM as detected by TREM2aSPR Assay (WeSPRTM 200).
Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Molecular Weight	22.5 kDa
Expression Region	19-174aa
Protein Length	Partial
Protein Sequence	HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Purity	Greater than 90% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Triggering receptor expressed on myeloid cells 2; TREM-2; Triggering receptor expressed on monocytes 2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial (Active)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

Q9NZC2

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols