Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

SKU: orb3004074

Description

This Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active) spans the amino acid sequence from region 20-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0） at 2 μg/mL can bind Human ACVR2A.The EC50 is 74.75-84.73 ng/mL.
Tag	C-terminal hFc1-tagged
Molecular Weight	42.3 kDa
Expression Region	20-135aa
Protein Length	Partial
Protein Sequence	AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxins	Less than 1.0 EU/ug as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Disclaimer	For research use only

Alternative Names

−

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA);ACVR2A; ACVR2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

A0A7N9IF81, P27037

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols