You have no items in your shopping cart.
Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)
SKU: orb3004074
Active
Description
Research Area
Signal Transduction
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0) at 2 μg/mL can bind Human ACVR2A.The EC50 is 74.75-84.73 ng/mL. |
| Tag | C-terminal hFc1-tagged |
| Molecular Weight | 42.3 kDa |
| Expression Region | 20-135aa |
| Protein Length | Partial |
| Protein Sequence | AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA);ACVR2A; ACVR2
Similar Products
−Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active) [orb2658319]
Greater than 90% as determined by SDS-PAGE.
15.5 kDa
Yeast
1 mg, 100 μg, 20 μgRecombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active) [orb2658698]
Greater than 95% as determined by SDS-PAGE.
14.8 kDa
Mammalian cell
100 μg, 1 mg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active) (orb3004074)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


