You have no items in your shopping cart.
Recombinant IL-27 EBI3 (Interleukin-27 EBI3), Mouse, AF
SKU: orb1178948
Description
Images & Validation
−
| Tested Applications | ELISA |
|---|
Key Properties
−| Source | Escherichia coli |
|---|---|
| Biological Activity | Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 ng/mL. |
| Reactivity | Mouse |
| Tag | His-tag at the N-terminus |
| Protein Sequence | MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP with polyhistidine tag at the C-terminus. |
| Purity | >95% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Endotoxins | <0.1 EU per 1 μg of the protein by the LAL method. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-27 subunit alpha, IL-27-A, Interleukin-27 subunit beta, IL-27B, Epstein-Barr virus-in_x005f_x0002_duced gene 3 protein, EBV-induced gene 3 protein, EBI3, p28, Interleukin-30, IL-30

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Recombinant IL-27 EBI3 (Interleukin-27 EBI3), Mouse, AF (orb1178948)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review