Cart summary

You have no items in your shopping cart.

Recombinant IL-36RA (Interleukin-36 receptor antagonist), Human, Animal-Free

SKU: orb1179043

Description

Recombinant IL-36RA (Interleukin-36 receptor antagonist), Human, Animal-Free

Images & Validation

Tested ApplicationsCell Culture, ELISA

Key Properties

SourceEscherichia coli
Expression SystemEscherichia coli
Biological OriginHuman
Biological ActivityMeasure by its ability to inhibit IL-36 gamma-induced IL-8 secretion in PBMC cells. The ED50 for this effect is <2 ng/mL in the presence of 500 ng/mL of recombinant human IL-36 gamma.
ReactivityHuman
TagHis-tag at the N-terminus
Protein SequenceMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLT SSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD with polyhistidine tag at the C-terminus.
Purity>98% as determined by SDS-PAGE. Ni-NTA chromatography.
Endotoxins<0.1 EU per 1 μg of the protein by the LAL method.

Storage & Handling

StorageLyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Form/AppearanceLyophilized
Buffer/PreservativesThe protein was lyophilized from a solution containing 1X PBS, pH 7.4.
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra Homolog 1, IL-1 delta
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

NCBI Gene Details

No NCBI Gene data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

ELISA
Enzyme-linked Immunosorbent Assay (EIA)
View Protocol

Recombinant IL-36RA (Interleukin-36 receptor antagonist), Human, Animal-Free (orb1179043)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 120.00
20 μg
$ 270.00
100 μg
$ 680.00
500 μg
$ 1,650.00
1 mg
$ 2,800.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry