You have no items in your shopping cart.
Recombinant Macaca fascicularis G-protein coupled receptor 20 (GPR20)-VLPs (Active)
SKU: orb2658865
Featured
Description
Images & Validation
−Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody. The EC50 is 3.549 - 6.542 ng/mL. The VLPs is negative control. |
| Tag | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Molecular Weight | 40.2 kDa |
| Expression Region | 1-359aa |
| Protein Length | Full Length |
| Protein Sequence | MPSVSPVGPSAGAVPNATAVTTVWTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLVGLVLNGLALYVFCCRTQAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLHCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGMTGGRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHASLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHRGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA |
| Purity | The purity information is not available for VLPs proteins. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Detected by Mouse anti-6*His monoclonal antibody. (This tag can be tested only under denaturing conditions.)
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 μg/ml can bind Anti-GPR20 recombinant antibody. The EC50 is 3.549 - 6.542 ng/mL.The VLPs is negative control.
The purity of VLPs was greater than 95% as determined by SEC-HPLC
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Macaca fascicularis G-protein coupled receptor 20 (GPR20)-VLPs (Active) (orb2658865)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days