You have no items in your shopping cart.
Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Macaca mulatta (Rhesus macaque) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody. The EC50 is 4.473-4.933 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 19-141aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 15.3 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody. The EC50 is 4.473-4.933 ng/mL.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active) (orb2992168)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review