You have no items in your shopping cart.
Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2b at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 7.196-8.315 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 15.7 kDa |
| Expression Region | 19-137aa |
| Protein Length | Partial |
| Protein Sequence | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTLLT |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active) [orb2658695]
Greater than 95% as determined by SDS-PAGE.
15.2 kDa
Mammalian cell
1 mg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2b at 2 μg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 7.196-8.315 ng/mL.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active) (orb2658318)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

