You have no items in your shopping cart.
Recombinant Mouse C-X-C motif chemokine 2 (Cxcl2)
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 11.8 kDa |
| Expression Region | 28-100aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Not test |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse CXCL2 [orb3002242]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 7.9 KDa. Observed: 10 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant human CXCL1 protein [orb1817164]
>90% as determined by SDS-PAGE
8 kDa
20 μg, 100 μg, 500 μgRecombinant mouse CXCL2 protein, N-His [orb1974375]
>90% as determined by SDS-PAGE
11.7 kDa
100 μg, 500 μg, 20 μgMouse CXCL2 protein [orb707182]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
50 μg, 10 μg, 500 μgMouse CXCL2 protein [orb754071]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
7.9 kDa
E.Coli
100 μg, 50 μg, 200 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Mouse C-X-C motif chemokine 2 (Cxcl2) (orb3053903)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
