You have no items in your shopping cart.
Recombinant Mouse IL-1 beta
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Molecular Weight | 17.4 kDa |
| Protein Sequence | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Mouse IL-1b [orb3002456]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 17.4 KDa. Observed: 16 KDa, reducing conditions
50 μg, 500 μg, 1 mg, 10 μgMouse IL-1R2 [orb3002198]
SDS-PAGE: Greater than 80% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 64.9 KDa. Observed: 85-110 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgMouse IL-1R2 [orb3002218]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 39 KDa. Observed: 45-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant mouse IL-1b protein, C-His [orb1516852]
>95% as determined by SDS-PAGE
26 kDa
500 μg, 100 μg, 20 μgRecombinant Mouse IL1RAP Protein, N-His [orb2962422]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
40.54 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Request a Document
Protocol Information
Recombinant Mouse IL-1 beta (orb623192)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review