Cart summary

You have no items in your shopping cart.

Recombinant Mouse IL-1 beta

SKU: orb623192

Description

IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.

Images & Validation

Application Notes
The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
Molecular Weight17.4 kDa
Protein SequenceVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Mouse IL-1b [orb3002456]

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 17.4 KDa. Observed: 16 KDa, reducing conditions

    50 μg, 500 μg, 1 mg, 10 μg
  • Mouse IL-1R2 [orb3002198]

    SDS-PAGE: Greater than 80% as determined by reducing SDS-PAGE. (QC verified)

    Predicted: 64.9 KDa. Observed: 85-110 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Mouse IL-1R2 [orb3002218]

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 39 KDa. Observed: 45-60 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant mouse IL-1b protein, C-His [orb1516852]

    >95% as determined by SDS-PAGE

    26 kDa

    500 μg, 100 μg, 20 μg
  • Recombinant Mouse IL1RAP Protein, N-His [orb2962422]

    ELISA,  SDS-PAGE,  WB

    >90% as determined by SDS-PAGE.

    40.54 kDa

    1 mg, 50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Mouse IL-1 beta (orb623192)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry