You have no items in your shopping cart.
Recombinant Mouse IL-10
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Molecular Weight | 18.8 kDa |
| Protein Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Mouse IL-22 [orb2995243]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
Predicted: 16.7 KDa. Observed: 15 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgMouse IL-22 [orb2994339]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 43.8 KDa. Observed: 50-65 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgMouse IL-10 [orb3002434]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
Predicted: 18.9 KDa. Observed: 16 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant mouse IL-10 protein, N-His (HEK293) [orb1516603]
>90% as determined by SDS-PAGE
20.6 kDa
100 μg, 500 μg, 20 μgRecombinant Mouse IL10 Protein, N-His [orb2963218]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
21.05 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Request a Document
Protocol Information
Recombinant Mouse IL-10 (orb623198)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review