Cart summary

You have no items in your shopping cart.

Recombinant Mouse IL-10

SKU: orb623198

Description

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Images & Validation

Application Notes
The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
Molecular Weight18.8 kDa
Protein SequenceSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Mouse IL-22 [orb2995243]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)

    Predicted: 16.7 KDa. Observed: 15 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Mouse IL-22 [orb2994339]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 43.8 KDa. Observed: 50-65 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Mouse IL-10 [orb3002434]

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)

    Predicted: 18.9 KDa. Observed: 16 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant mouse IL-10 protein, N-His (HEK293) [orb1516603]

    >90% as determined by SDS-PAGE

    20.6 kDa

    100 μg, 500 μg, 20 μg
  • Recombinant Mouse IL10 Protein, N-His [orb2963218]

    ELISA,  SDS-PAGE,  WB

    >90% as determined by SDS-PAGE.

    21.05 kDa

    1 mg, 50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Mouse IL-10 (orb623198)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry