Recombinant Mouse IL-10

SKU: orb623198

Description

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Images & Validation

−

Application Notes	The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.

Key Properties

−

Source	Yeast
Molecular Weight	18.8 kDa
Protein Sequence	SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Disclaimer	For research use only

Mouse IL-22 [orb2995243]

Conjugation:	Unconjugated
Purity:	SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
MW:	Predicted: 16.7 KDa. Observed: 15 KDa, reducing conditions

Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg

Item 1 of 1
Recombinant mouse IL-10 protein, N-His (HEK293) [orb1516603]
Purity:
>90% as determined by SDS-PAGE
MW:
20.6 kDa
Sizes Available: 100 μg, 500 μg, 20 μg
Recombinant Mouse IL10 Protein, N-His [orb2963218]
Purity:
>90% as determined by SDS-PAGE.
MW:
21.05 kDa
Sizes Available: 1 mg, 100 μg, 50 μg

Mouse IL-10 [orb3002434]

Purity:	SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
MW:	Predicted: 18.9 KDa. Observed: 16 KDa, reducing conditions

Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols