You have no items in your shopping cart.
Recombinant Mouse IL-6
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Molecular Weight | 21.7 kDa |
| Protein Sequence | FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Disclaimer | For research use only |
Similar Products
−Mouse IL-6 [orb2994610]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
Predicted: 21.8 KDa. Observed: 22 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant mouse IL-6 protein, C-His [orb1516900]
>95% as determined by SDS-PAGE
26 kDa
100 μg, 20 μg, 500 μgMouse IL-6 [orb3002517]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 22.6 KDa. Observed: 20-38 KDa, reducing conditions
1 mg, 500 μg, 50 μg, 10 μgMouse IL6 Protein, hFc Tag [orb1826783]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 47.9 kDa after removal of the signal peptide. The apparent molecular mass of mIL6-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgRecombinant Mouse CD126/IL6R/IL-6RA Protein, N-His [orb2962544]
>90% as determined by SDS-PAGE.
33.26 kDa
1 mg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Request a Document
Protocol Information
Recombinant Mouse IL-6 (orb623197)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

