Recombinant Mouse Leukemia inhibitory factor (Lif) (Active)

SKU: orb2657916

Featured

Description

This Recombinant Mouse Leukemia inhibitory factor (Lif) (Active) spans the amino acid sequence from region 24-203aa. Purity: Greater than 95% as determined by SDS-PAGE.

Images & Validation

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Mus musculus (Mouse)
Biological Activity	Measured in the M1 cell differentiation assay. The ED50 is ≤0.2ng/ml.
Tag	Tag free
Molecular Weight	19.9 kDa
Expression Region	24-203aa
Protein Length	Full Length of Mature Protein
Protein Sequence	SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxins	≤10 EU/mg by the LAL method

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered solution containing PBS,5%mannitoland0.01% Tween 80, pH 7.4
Disclaimer	For research use only

Alternative Names

−

Leukemia Inhibitory Factor; LIF; Differentiation-Stimulating Factor; D Factor; Melanoma-Derived LPL Inhibitor; MLPLI; Emfilermin; LIF; HILDA

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

P09056

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols