Recombinant Mouse Mast/stem cell growth factor receptor Kit (Kit), partial (Active)

SKU: orb2985923

Active

Description

This Recombinant Mouse Mast/stem cell growth factor receptor Kit (Kit), partial spans the amino acid sequence from region 25-523aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

−

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Mus musculus (Mouse)
Biological Activity	①Measured by its binding ability in a functional ELISA.Immobilized Mouse Kit at 2 μg/mL can bind Mouse Kitlg (CSB-MP012376MO1d9). The EC50 is 19.35-24.80 ng/mL. ②Mouse Kitlg (CSB-MP012376MO1d9) captured on Protein A Chip can bind Recombinant Mouse Kit with an affinity constant of 15.1 nM as detected by MetaSPR Assay (WeSPRTM 200).
Tag	C-terminal 10xHis-tagged
Molecular Weight	56.9 kDa
Expression Region	25-523aa
Protein Length	Partial of Isoform 2
Protein Sequence	SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKEQIQAHTLFTP
Purity	Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Mast/stem cell growth factor receptor Kit; SCFR; EC 2.7.10.1; Proto-oncogene c-Kit; Tyrosine-protein kinase Kit; CD antigen CD117

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

P05532

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols