You have no items in your shopping cart.
Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain(Cd8a)
Description
Images & Validation
−
Key Properties
−| Biological Origin | Mus musculus (Mouse) |
|---|---|
| Expression Region | 28-247 |
| Protein Length | full length protein |
| Protein Sequence | KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Mouse CD8A Protein, N-GST & C-His [orb2963785]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
41.56 kDa
1 mg, 50 μg, 100 μgRecombinant Mouse CD8A Protein, N-GST & C-His [orb2832716]
>90% as determined by SDS-PAGE.
41.56 kDa
100 μg, 20 μg, 50 μgRecombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial, Biotinylated [orb3155971]
Greater than 95% as determined by SDS-PAGE.
22.4 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial [orb3155961]
Greater than 95% as determined by SDS-PAGE.
20.3 kDa
Mammalian cell
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain(Cd8a) (orb2902863)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review