You have no items in your shopping cart.
Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial
SKU: orb2659705
Featured
Description
Research Area
Neuroscience
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | Tag-Free |
| Molecular Weight | 17.3 kDa |
| Expression Region | 723-871aa |
| Protein Length | Partial |
| Protein Sequence | GQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVDEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSSADEVVVPLDNLGNPNCDGHQQGYAPKWRTDDAPL |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−TrpV4;Osm-9-like TRP channel 4;OTRPC4;Transient receptor potential protein 12;TRP12;Vanilloid receptor-like channel 2;Vanilloid receptor-like protein 2;Vanilloid receptor-related osmotically-activated channel;VR-OAC
Similar Products
−Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial [orb1881747]
Greater than 90% as determined by SDS-PAGE.
21.2 kDa
E.coli
100 μg, 20 μg, 1 mgRecombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial [orb2659570]
Greater than 90% as determined by SDS-PAGE.
59.9 kDa
E.coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial (orb2659705)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
