You have no items in your shopping cart.
Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial (Active)
SKU: orb2986912
Active
Description
Research Area
Cell Biology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Ltbr at 2 μg/ml can bind human TNFSF14, the EC50 is 15.43-18.78 ng/ml. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 23.1 kDa |
| Expression Region | 31-223aa |
| Protein Length | Partial |
| Protein Sequence | QLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLL |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Lymphotoxin-beta receptor
Similar Products
−Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial (Active) [orb2986412]
Greater than 95% as determined by SDS-PAGE.
50.6 kDa
Mammalian cell
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial (Active) (orb2986912)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review