You have no items in your shopping cart.
Recombinant Murine NOGGIN (rMuNOGGIN )
SKU: orb1494917
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia coli. |
|---|---|
| Biological Activity | Determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 1.0-2.0 ng/ml of Noggin, corresponding to a Specific Activity of >5 x 105 IU/mg. |
| Molecular Weight | Approximately 46.4 kDa disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains. |
| Protein Sequence | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSV PEGMVCKPSK SVHLTVLRWR CQRRGGQRCG WIPIQYPIIS ECKCSC |
| Purification | >95% by SDS-PAGE and HPLC analyses. |
| Purity | >95% by SDS-PAGE and HPLC analyses. |
| Endotoxins | Less than 1EU/mg of rMuNOGGIN as determined by LAL method. |
Storage & Handling
−| Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA. |
| Buffer/Preservatives | Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Murine Noggin(rMuNoggin) [orb1631597]
> 95 % by SDS-PAGE and HPLC analyses.
Approximately 46.4 kDa, a disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.
Murine
20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Murine NOGGIN (rMuNOGGIN ) (orb1494917)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review