Cart summary

You have no items in your shopping cart.

Recombinant Porcine respiratory coronavirus Membrane protein(M)

SKU: orb2927964

Description

This Recombinant Porcine respiratory coronavirus Membrane protein(M) spans the amino acid sequence from region 18-262.

Images & Validation

Key Properties

Biological OriginPorcine respiratory coronavirus (strain RM4) (PRCoV) (PRCV)
Expression Region18-262
Protein Lengthfull length protein
Protein SequenceRYCAMKDDTGLSCRNGTASDCESCFNRGDLIWLLANWNFSWSIILIIFITVLQYGRPQFS WFVYGIKMLIMWLLWPIVLALTIFNAYSEYQVSRYVMFGFSIAGAIVTFVLWIMYFVRSI QLYRRTKSWWSFNPETNAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGM TIDNLPKYVMVALPSRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTEARTDNLSEQEK LLHMV

Storage & Handling

StorageStorage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Form/AppearanceLyophilized powder
Buffer/PreservativesTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Porcine respiratory coronavirus Membrane protein(M) (orb2927964)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 1,980.00
100 μg
$ 3,320.00
DispatchUsually dispatched within 15-40 working days
Bulk Enquiry