Recombinant Rat Tumor necrosis factor (Tnf), partial (Active)

SKU: orb2985847

Description

This Recombinant Rat Tumor necrosis factor (Tnf), partial spans the amino acid sequence from region 80-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Cancer Biology, Immunology & Inflammation

Images & Validation

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Yeast
Biological Origin	Rattus norvegicus (Rat)
Biological Activity	Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 18.58-33.99 pg/mL.
Tag	N-terminal 6xHis-tagged
Molecular Weight	19.2 kDa
Expression Region	80-235aa
Protein Length	Partial
Protein Sequence	LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Purity	Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Disclaimer	For research use only

Alternative Names

−

Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2 (TNF-a); Tumor necrosis factor, membrane form Alternative names: N-terminal fragment (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form; Tnf; Tnfa, Tnfsf2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

P16599

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols