Cart summary

You have no items in your shopping cart.

RecombinantCT-1,Human

SKU: orb1494756

Description

Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceCHO
Biological ActivityED50 < 0.4 ng/ml, measured in a cell proliferation assay using TF-1 cells.
Molecular Weight24~26kDa, observed by reducing SDS-PAGE.
Protein SequenceSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGL PVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASA ASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Purification> 95% as analyzed by SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant Human Cardiotrophin-1°CT-1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Cardiotrophin-1°CT-1) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
DisclaimerFor research use only

Alternative Names

CT1
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantCT-1,Human (orb1494756)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 200.00
50 μg
$ 530.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry