RecombinantFasR,Human

SKU: orb1494650

Description

Fas Receptor and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD followed by processing of the pro-enzyme to active forms. These active caspases then cleave various cellular substrates leading to the eventual cell death. sFasR is capable of inhibiting FasL-induced apoptosis by acting as a decoy receptor that serves as a sink for FasL.

Images & Validation

−

Application Notes	Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

−

Source	HEK 293
Biological Activity	ED50 < 0.4 μg/ml, measured by its ability to inhibit the cytotoxicity of Jurkat cells in the presence of 20ng/ml of human Fas Ligand.
Molecular Weight	17~29 kDa, observed by reducing SDS-PAGE.
Protein Sequence	QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCR LCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS
Purification	> 95% as analyzed by SDS-PAGE.
Purity	> 95% as analyzed by SDS-PAGE.
Endotoxins	< 0.2 EU/μg, determined by LAL method.

Storage & Handling

−

Storage	Lyophilized recombinant Human Fas Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fas Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/Appearance	Lyophilized after extensive dialysis against PBS.
Buffer/Preservatives	Lyophilized after extensive dialysis against PBS.
Disclaimer	For research use only

Alternative Names

−

soluble Fas receptor (sFasR), TNFRSF6, CD95, Apo I, Fas Antigen

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols