Cart summary

You have no items in your shopping cart.

RecombinantG-CSF,Rat(HEK293-expressed)

SKU: orb1494648

Description

Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceHEK 293
Biological ActivityED50 < 5 pg/ml, measured in a cell proliferation assay using NFS-60 cells.
Molecular Weight25~28 kDa, observed by reducing SDS-PAGE.
Protein SequenceIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKC LSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVT SYLQSFLETAHHALHHLPRPAQKHFPESLFISI
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Granulocyte Colony-Stimulating Factor, CSF-3, CSF3, MGI-1G, GM-CSFb, pluripoietin
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantG-CSF,Rat(HEK293-expressed) (orb1494648)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 200.00
50 μg
$ 530.00