Cart summary

You have no items in your shopping cart.

RecombinantIL-10,Mouse(CHO-expressed)

SKU: orb1494722

Description

Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF, by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceCHO
Biological ActivityED50 < 0.2 ng/ml, measured in a cell proliferation assay using MC/9 cells.
Molecular Weight21-23 kDa, observed by reducing SDS-PAGE.
Protein SequenceSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQA EKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant murine Interleukin-10 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-10 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Interleukin-10, IL10
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantIL-10,Mouse(CHO-expressed) (orb1494722)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 200.00
50 μg
$ 530.00