RecombinantIL-4,His,Rat

SKU: orb1494706

Description

Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.

Images & Validation

−

Application Notes	Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

−

Source	CHO
Biological Activity	ED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells.
Molecular Weight	18-22 kDa, observed by reducing SDS-PAGE.
Protein Sequence	HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH
Purification	> 95% as analyzed by SDS-PAGE.
Purity	> 95% as analyzed by SDS-PAGE.
Endotoxins	< 0.2 EU/μg, determined by LAL method.

Storage & Handling

−

Storage	Lyophilized recombinant rat Interleukin-4 (IL-4), Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-4 (IL-4), Hisshould be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/Appearance	Lyophilized after extensive dialysis against PBS.
Buffer/Preservatives	Lyophilized after extensive dialysis against PBS.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Interleukin-4, IL4

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols