RecombinantIL-6,Human(CHO-expressed)

SKU: orb1494697

Description

Interleukin-6 (IL-6), also known as BSF-2, CDF and IFNB2, is a pleiotropic cytokine that acts in both pro-inflammatory and anti-inflammatory responses. It is produced mainly by T cells, macrophages, monocytes, endothelial cells and muscle cells. IL-6 binds to IL-6 receptor (IL-6R) to trigger the association of IL-6R with gp130, inducing signal transduction through JAKs and STATs. The biological functions of IL-6 are diverse. It stimulates B cell differentiation and antibody production, myeloma and plasmacytoma growth, as well as nerve cell differentiation. It also acts as a myokine, produced by muscle cells in response to muscle contraction, to be released to the blood stream to help break down fats and improve insulin resistance.

Images & Validation

−

Application Notes	Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

−

Source	CHO
Biological Activity	ED50 < 0.06 ng/ml, measured in a cell proliferation assay using 7TD1 cells.
Molecular Weight	21-23 kDa, observed by reducing SDS-PAGE.
Protein Sequence	PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD MTTHLILRSFKEFLQSSLRALRQM
Purification	> 95% as analyzed by SDS-PAGE.
Purity	> 95% as analyzed by SDS-PAGE.
Endotoxins	< 0.2 EU/μg, determined by LAL method.

Storage & Handling

−

Storage	Lyophilized recombinant Human Interleukin-6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/Appearance	Lyophilized after extensive dialysis against PBS.
Buffer/Preservatives	Lyophilized after extensive dialysis against PBS.
Disclaimer	For research use only

Alternative Names

−

Interleukin-6, IL6

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols