RecombinantIL-6R,Human

SKU: orb1494696

Description

Interleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity.

Images & Validation

−

Application Notes	Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

−

Source	CHO
Biological Activity	ED50 < 0.2 μg/ml, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/ml human IL-6.
Molecular Weight	54-56 kDa, observed by reducing SDS-PAGE.
Protein Sequence	LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD DDNILFRDSANATSLPVQDSSSVPLP
Purification	> 95% as analyzed by SDS-PAGE and HPLC.
Purity	> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins	< 0.2 EU/μg, determined by LAL method.

Storage & Handling

−

Storage	Lyophilized recombinant Human Interleukin-6 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/Appearance	Lyophilized after extensive dialysis against PBS.
Buffer/Preservatives	Lyophilized after extensive dialysis against PBS.
Disclaimer	For research use only

Alternative Names

−

IL-6RA, IL-6R1, CD126

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols