Cart summary

You have no items in your shopping cart.

RecombinantMCP-1/CCL2,Rat

SKU: orb1494632

Description

Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.Recombinant rat MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 125 amino acids. A fully biologically active molecule, rrMCP-1/CCL2 has a molecular mass of 10-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceHEK 293
Biological ActivityThe EC50 value of rat MCP-1/CCL2 on Caˆ2+ mobilization assay in CHO-K1/G15/rCCR2 cells (human G15 and rat CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/ml.
Molecular Weight10~15 kDa, observed by reducing SDS-PAGE.
Protein SequenceQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWV QKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVT SMTEN
Purification> 98% as analyzed by SDS-PAGE.
Purity> 98% as analyzed by SDS-PAGE.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant Rat MCP-1°CCL2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat MCP-1°CCL2 should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MCP-1; Monocyte Chemotactic Protein-1, CCL2, MCAF
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantMCP-1/CCL2,Rat (orb1494632)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 180.00
25 μg
$ 450.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry