You have no items in your shopping cart.
RecombinantMIP-1β/CCL4,Human
SKU: orb1494680
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | CHO |
|---|---|
| Biological Activity | The EC50 value of human MIP-1 beta /CCL4 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells) is less than 150 ng/ml. |
| Molecular Weight | 10-19 kDa, observed by reducing SDS-PAGE. |
| Protein Sequence | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQ EYVYDLELN |
| Purification | > 95% as analyzed by SDS-PAGE and HPLC. |
| Purity | > 95% as analyzed by SDS-PAGE and HPLC. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage & Handling
−| Storage | Lyophilized recombinant Human MIP-1β/CCL4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1β/CCL4 should be stable up to 1 week at 4°C or up to 3 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−MIP1β, Macrophage Inflammatory Protein-1β, CCL4, ACT-2
Similar Products
−RecombinantMIP-1β/CCL4,Human [orb1494792]
> 95% as analyzed by SDS-PAGE and HPLC.
7.6 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
5 μg, 25 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
RecombinantMIP-1β/CCL4,Human (orb1494680)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review