Cart summary

You have no items in your shopping cart.

RecombinantMPIF-1/CCL23,Human

SKU: orb1494677

Description

Myeloid progenitor inhibitory factor 1 (MPIF-1), also known as Chemokine (C-C motif) ligand 23 (CCL23) is a small cytokine belonging to the CC chemokine family.MPIF-1is predominantly expressed in lung and liver tissue, but is also found in bone marrow and placenta. It is also expressed in some cell lines of myeloid origin. It is highly chemotactic for resting T cells and monocytes and slightly chemotactic for neutrophils. MPIF-1 has been shown to inhibit colony formation of bone marrow myeloid immature progenitors. It has also been attributed to an inhibitory activity on hematopoietic progenitor cells. MPIF-1 is a ligand for the chemokine receptor CCR1.Recombinant human MPIF-1/CCL23 produced in CHO cells is a single polypeptide chain containing 99 amino acids. A fully biologically active molecule, rhMPIF-1/CCL23 has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceCHO
Biological ActivityThe EC50 value of human MPIF-1/CCL23 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 2 μg/ml.
Molecular Weight12 kDa, observed by reducing SDS-PAGE.
Protein SequenceRVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKP GVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN
Purification> 98% as analyzed by SDS-PAGE.
Purity> 98% as analyzed by SDS-PAGE.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant humanMPIF-1°CCL23 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human MPIF-1°CCL23 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
DisclaimerFor research use only

Alternative Names

MPIF-1, CCL23
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantMPIF-1/CCL23,Human (orb1494677)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 180.00
50 μg
$ 450.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry