RecombinantOSM,Mouse(HEK293-expressed)

SKU: orb1494628

Description

Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.

Images & Validation

−

Application Notes	Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

−

Source	HEK 293
Biological Activity	ED50 < 0.4 ng/ml, measured in a cell proliferation assay using NIH-3T3 cells.
Molecular Weight	10-40 kDa, observed by reducing SDS-PAGE.
Protein Sequence	ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRV LYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGY HRFMGSVGRVFREWDDGSTRSRR
Purification	> 95% as analyzed by SDS-PAGE and HPLC.
Purity	> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins	< 0.2 EU/μg, determined by LAL method.

Storage & Handling

−

Storage	Lyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/Appearance	Lyophilized after extensive dialysis against PBS.
Buffer/Preservatives	Lyophilized after extensive dialysis against PBS.
Disclaimer	For research use only

Alternative Names

−

Oncostatin M

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols