You have no items in your shopping cart.
RecombinantPF-4/CXCL4,Human
SKU: orb1494626
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | HEK 293 |
|---|---|
| Biological Activity | ED50 < 10 ug/ml, measured by its ability to inhibit human FGF-basic-dependent proliferation of NR6R 3T3 mouse fibroblast cells. |
| Molecular Weight | ~7.8 kDa, observed by non-reducing SDS-PAGE. |
| Protein Sequence | EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES |
| Purification | > 95% as analyzed by SDS-PAGE and HPLC. |
| Purity | > 95% as analyzed by SDS-PAGE and HPLC. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage & Handling
−| Storage | Lyophilized recombinant human platelet factor 4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human platelet factor 4 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PF-4, CXCL4, SCYB4,Platelet Factor-4, CXCL4, Oncostatin A, Ironplact

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
RecombinantPF-4/CXCL4,Human (orb1494626)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review