You have no items in your shopping cart.
RecombinantSCF,Rat(HEK293-expressed)
SKU: orb1494624
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | HEK 293 |
|---|---|
| Biological Activity | ED50 < 50 ng/ml, measured in a proliferation assay using TF-1 Cells. |
| Molecular Weight | 10~20 kDa, observed by reducing SDS-PAGE. |
| Protein Sequence | QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLG KIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFML PPVA |
| Purification | > 95% as analyzed by SDS-PAGE. |
| Purity | > 95% as analyzed by SDS-PAGE. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage & Handling
−| Storage | Lyophilized recombinant Rat Stem Cell Factor (SCF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Stem Cell Factor (SCF) should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Disclaimer | For research use only |
Alternative Names
−C-Kit Ligand, Mast Cell Growth Factor (MGF), Steel Factor

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
RecombinantSCF,Rat(HEK293-expressed) (orb1494624)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review