Cart summary

You have no items in your shopping cart.

RecombinantTRAIL/Apo2L,Human

SKU: orb1494764

Description

TRAIL/Apo2L, also known as Tumor Necrosis Factor Super-Family 10 (TNFSF10), is a pleiotropic cytokine thatbelongs to the TNF superfamily. The full length TRAIL expressed in vivo is a Type II transmembrane protein, although the soluble form also exists and functions. TRAIL has four major receptors: two death receptors DR4 and DR5, two decoy receptors DcR1 and DcR2. TRAIL binds to the death receptors, recruits the FAS-associated death domain, activates caspases 8 and 10, and eventually leads to apoptosis. Because of its antitumor potential, TRAIL is actively studied as a therapeutic agent. On the other hand, abnormal expression of TRAIL in small arteries can induce the proliferation of smooth muscle cells, resulting in increasing vascular remodeling and pulmonary arterial hypertension. Recombinant human TRAIL/Apo2L (rhTRAIL) produced in E.coli is a single non-glycosylated polypeptide chain containing 169 amino acids. A fully biologically active molecule, rhTRAIL has a molecular mass of 19.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques at GenScript.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceEscherichia coli.
Biological ActivityED50 2.5 × 10ˆ4 units/mg.
Molecular Weight19.6 kDa, observed by reducing SDS-PAGE.
Protein SequenceMVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGE LVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSK DAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant human TRAIL/Apo2L (rhTRAIL) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhTRAIL remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TNF-related apoptosis-inducing Ligand, TNFSF10, Apo2 Ligand, TL2
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantTRAIL/Apo2L,Human (orb1494764)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 180.00
50 μg
$ 290.00