Cart summary

You have no items in your shopping cart.

RecombinantVEGF165,Human(HEK293-expressed)

SKU: orb1494620

Description

Vascular Endothelial Growth Factor is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the mouse homolog of KDR is the flk-1 gene product) and the flt4 gene product.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceHEK 293
Biological ActivityED50 < 16 ng/ml, measured in a cell proliferation assay using HUVEC cells.
Molecular Weight20~26 kDa, observed by reducing SDS-PAGE.
Protein SequenceAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQI MRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRC DKPRR
Purification> 95% as analyzed by SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant Human Vascular Endothelial Growth Factor 165 (VEGF-165) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor 165 (VEGF-165) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Vascular Endothelial Growth Factor, VPF, Folliculostellate cell-derived growth factor, Glioma-derived endothelial cell mitogen
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantVEGF165,Human(HEK293-expressed) (orb1494620)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 200.00
50 μg
$ 530.00