You have no items in your shopping cart.
RHBDF1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RHBDF1 |
| Target | RHBDF1 |
| Protein Sequence | Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR |
| Molecular Weight | 97 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RHBDF1 Rabbit Polyclonal Antibody (HRP) [orb2112722]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
HRP
100 μlRHBDF1 Rabbit Polyclonal Antibody (FITC) [orb2112723]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
FITC
100 μlRHBDF1 Rabbit Polyclonal Antibody (Biotin) [orb2112724]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
Biotin
100 μlRHBDF1 Rabbit Polyclonal Antibody (HRP) [orb473926]
ELISA
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Rabbit
Polyclonal
HRP
100 μlRHBDF1 Rabbit Polyclonal Antibody (Biotin) [orb452094]
ELISA
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms present from ~95 kDa to ~80 kda and another isoform is present ~54 kDa.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

Positive control (+): Human stomach (ST), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-RHBDF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.
Documents Download
Request a Document
RHBDF1 Rabbit Polyclonal Antibody (orb580834)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review