Cart summary

You have no items in your shopping cart.

RYMV P1 Antibody

SKU: orb334975

Description

Goat polyclonal antibody to P1 protein from rice yellow mottle virus (RYMV). P1 protein is a product from the gene ORF1. This protein has a possible role in suppression of post-transcriptional gene silencing and viral movement.

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:500-1:2,000
ReactivityVirus
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 55 aa to N-terminal of RYMV P1 produced in E. coli. Antigen Sequence: MTRLEVLIRPTEQTVAKAIAVGYTHTLTWVWYPQTWDVDSVNDPVLRADFDPDRAG
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

P1 (ORF1), RYMV, Rice Yellow Mottle Virus antibody.
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

RYMV P1 Antibody

Western blot analysis of staining of MBP-RYMV P1 N-term recombinant protein and HEK293 transfected cell lysate using RYMV P1 antibody

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RYMV P1 Antibody (orb334975)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 280.00
DispatchUsually dispatched within 2-3 days
Bulk Enquiry