You have no items in your shopping cart.
RYMV P1 Antibody
SKU: orb334975
Description
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:500-1:2,000 |
| Reactivity | Virus |
| Application Notes |
Key Properties
−| Host | Goat |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 55 aa to N-terminal of RYMV P1 produced in E. coli. Antigen Sequence: MTRLEVLIRPTEQTVAKAIAVGYTHTLTWVWYPQTWDVDSVNDPVLRADFDPDRAG |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. |
| Concentration | Please inquire |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−P1 (ORF1), RYMV, Rice Yellow Mottle Virus antibody.
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Western blot analysis of staining of MBP-RYMV P1 N-term recombinant protein and HEK293 transfected cell lysate using RYMV P1 antibody
Documents Download
Datasheet
Product Information
Request a Document
RYMV P1 Antibody (orb334975)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 2-3 days