SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag

SKU: orb669263

Description

SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD.

Images & Validation

−

Item 1 of 1

Key Properties

−

Source	E. coli
Reactivity	Mouse
Molecular Weight	22.7KD
Protein Sequence	AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Purification	> 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie? Blue Staining.Method of purification: Nickel column affinity purification
Endotoxins	Less than 1 EU/μg protein as determined by LAL method.

Storage & Handling

−

Storage	The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Form/Appearance	Lyophilized
Disclaimer	For research use only

Alternative Names

−

SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP8, Nonstructural Protein 8

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols