You have no items in your shopping cart.
SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag
SKU: orb669264
Description
Images & Validation
−Item 1 of 1
Key Properties
−| Source | E. coli |
|---|---|
| Reactivity | Mouse |
| Molecular Weight | 13.2KD |
| Protein Sequence | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Purification | > 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie? Blue Staining.Method of purification: Nickel column affinity purification |
| Endotoxins | Less than 1 EU/μg protein as determined by LAL method. |
Storage & Handling
−| Storage | The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Disclaimer | For research use only |
Alternative Names
−SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP9, Nonstructural Protein 9

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag (orb669264)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review