You have no items in your shopping cart.
Description
Research Area
Infectious Disease & Virology
Images & Validation
−
Item 1 of 1
Key Properties
−| Source | E. coli |
|---|---|
| Reactivity | Mouse |
| Purification | > 90%. as determined by SDS-PAGE with Coomassie Blue staining and quantitative densitometry. Purification method: Nickel column affinity chromatography. |
| Endotoxins | Less than 1 EU/μg protein as determined by LAL method. |
| MW | 13.2KD |
| Protein Sequence | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
Storage & Handling
−| Storage | The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | Lyophilized from sterile 20mM PB, 150mM NaCl, pH 7.3-7.4, 10% glycerol and 4% trehalose |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP9, Nonstructural Protein 9
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 2-4 weeks