SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody

SKU: orb1272801

Description

Research Area

Infectious Disease & Virology

Images & Validation

−

Tested Applications	ELISA
Reactivity	Virus
Application Notes	Elisa:1:4000~1:8000

Key Properties

−

Antibody Type	Primary Antibody
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Immunogen	MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/Appearance	Liquid
Buffer/Preservatives	PBS, pH 7.4, containing 0.05% proclin300, 50% glycerol.
Concentration	batch dependent
Disclaimer	For research use only

Alternative Names

−

Accessory protein 7a,Protein U122,Protein X4,ORF7a protein

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

ELISA

Enzyme-linked Immunosorbent Assay (EIA)

View Protocol

Find More Protocols