Cart summary

You have no items in your shopping cart.

SARS-CoV-2 (COVID-19) RBD Recombinant Protein

SKU: orb1231620

Description

SARS-CoV-2 (COVID-19) RBD Recombinant Protein

Research Area

Infectious Disease & Virology

Images & Validation

Tested ApplicationsELISA
Application Notes
ELISA

Key Properties

SourceHEK293 cells
Molecular WeightThe predicted molecular mass is ~33 kDa.
Protein SequenceRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESN KKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCS
Purity>95% by SDS Page

Storage & Handling

StorageThis recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles.
Form/AppearanceLiquid
Buffer/PreservativesThis recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added.
Concentration0.5 mg/ml
Expiration Date6 months from date of receipt.
Dry Ice ShippingPlease note: This product requires shipment on dry ice. A dry ice surcharge will apply.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SARS-CoV-2 (COVID-19) RBD Recombinant Protein

Purified SARS-CoV-2 Receptor Binding Domain (RBD) Spike Protein under non-reducing conditions. Lane 1-RBD Protein loaded at 10 μg. Lane 2-RBD Protein loaded 20 μg

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

ELISA
Enzyme-linked Immunosorbent Assay (EIA)
View Protocol

SARS-CoV-2 (COVID-19) RBD Recombinant Protein (orb1231620)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet